Sentencedict.com
 Directly to word page Vague search(google)
Home > Missing link in a sentence

Missing link in a sentence

  up(1)  down(0)
Sentence count:35+1Posted:2019-01-13Updated:2020-07-24
Similar words: the missing linkprocessing linemissinganglingmississippi rivermississippianjanglingbunglingMeaning: n. hypothetical organism formerly thought to be intermediate between apes and human beings. 
Random good picture Not show
31. The 47 million-year-old fossil is the missing link between man and ape as the creature had opposable thumbs, and fingernails.
32. The Debate on Influencing Doctors'Decisions : Are Drug Characteristics the Missing Link?
33. A palaeontologist at the British Museum assembled the bones and believed that they represented the "missing link" between humans and apes.
34. She is not a missing link, but her skeleton is half human, half chimp.
35. Hyperglycaemia and hyperinsulinemia: is insulin - degrading enzyme the missing link?
More similar words: the missing linkprocessing linemissinganglingmississippi rivermississippianjanglingbunglingdanglingganglingwanglinghissingminglingtinglingjinglingwranglingmississippikissingpissingkinglinessfiring lineuntanglingstranglingfishing linemailing listcutting linewaiting linetransmission linesinking feelingdividing line
Total 35, 30 Per page  2/2  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words